SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113478382|ref|YP_724443.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113478382|ref|YP_724443.1|
Domain Number 1 Region: 7-342
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.21e-102
Family Branched-chain alpha-keto acid dehydrogenase PP module 0.00000175
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113478382|ref|YP_724443.1|
Sequence length 343
Comment pyruvate dehydrogenase (lipoamide) [Trichodesmium erythraeum IMS101]
Sequence
MIQERTVPKFDTNSVKITKEKALILYEDMVLGRLFEDKCAEMYYRGKMFGFVHLYNGQEA
VSSGVIKAMRQDEDFVSSTYRDHVHALSAGVPAREVMAELFGKATGCSKGRGGSMHMFSA
THNLLGGYAFVAEGIPVATGAAFQSKYRRETMGNQAADQVTACFFGDGACNNGQFFECLN
MAALWKLPIIYVVENNKWAIGMAHERATSEPEIYKKAHAFGMVGVEVDGMDILAVHSAAQ
EAVARARAGEGPTLIEALTYRFRGHSLADPDELRDQEEKQYWFSRDPIKKFTTYLTENNL
VDVAELVAIDKKIENLITEAVDFATNSPEPGSDELYRYIFAED
Download sequence
Identical sequences Q10UV4
WP_011614263.1.43450 gi|113478382|ref|YP_724443.1| 203124.Tery_5066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]