SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113474480|ref|YP_720541.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113474480|ref|YP_720541.1|
Domain Number 1 Region: 143-459
Classification Level Classification E-value
Superfamily TPR-like 5.97e-37
Family Tetratricopeptide repeat (TPR) 0.016
Further Details:      
 
Domain Number 2 Region: 1149-1447
Classification Level Classification E-value
Superfamily TPR-like 3.79e-34
Family Tetratricopeptide repeat (TPR) 0.011
Further Details:      
 
Domain Number 3 Region: 467-731
Classification Level Classification E-value
Superfamily TPR-like 5.82e-29
Family Tetratricopeptide repeat (TPR) 0.018
Further Details:      
 
Domain Number 4 Region: 739-1002
Classification Level Classification E-value
Superfamily TPR-like 1.75e-28
Family Tetratricopeptide repeat (TPR) 0.018
Further Details:      
 
Domain Number 5 Region: 10-141
Classification Level Classification E-value
Superfamily TPR-like 1.52e-25
Family Tetratricopeptide repeat (TPR) 0.008
Further Details:      
 
Domain Number 6 Region: 969-1139
Classification Level Classification E-value
Superfamily TPR-like 3.29e-22
Family Tetratricopeptide repeat (TPR) 0.016
Further Details:      
 
Domain Number 7 Region: 1632-1801
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000027
Family Tetratricopeptide repeat (TPR) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|113474480|ref|YP_720541.1|
Sequence length 2059
Comment hypothetical protein Tery_0626 [Trichodesmium erythraeum IMS101]
Sequence
MTIANPIKKVNQLLRERKFDDAFKECQKSIEVNPNFSWNYYYLGKILAAQNKWQEALIQY
EEAVKINPNSATFYYSLAKTLRHQGQLDEAIKYLKIAISLKNNVIIYQQTLAEVYEVKFD
FVGAFKIWQEIIAINYNHPVATKKIHWLRTDIVRDFVENGDKLNKEGKIKEAVNFYQQAL
TINSQQPMPIYRNFGNNLITLGKFEEAETVFKQLKEMYPELTDGYEGYARLTHSLGNWEL
ALKRWENAIEKFPENIGFQTQKGNMLINLSRFDEAESVFQSLKEKFPHQPQGYDGYARLT
HSFADWNLALKRWENAIEKFPEHIGFQTQKGNILINLSRFDEAESVFQRLIEKFPHQPQG
YDGYAKLTYRFADWNLALKRWENAIEKFPENIGFQTQKGNMLINLSRFDEAESVFQRLIE
KFPHQPQGYDGYARLTHSFADWNLALKRWENAIEKFPENIGFQTQKGNMLINLSRFDEAE
SVFQRLIEKFPHQPQGYDGYARLTHSFADWNLALKRWENAIEKFPENIGFQTQKGNMLIN
LSRFDEAESVFQRLIEKFPHQPQGYDGYARLTHSFADWNLALKRWENAIEKFPEHIGFQT
QKGNILINLSRFDEAESVFQRLIEKFPHQPQGYDGYARLTHRFADWNLALKRWENAIEKF
PENIGFQTQKGNMLINLSRFDEAESVFQRLIEKFPHQPQGYDGYARLTHSFADWNLALKR
WENAIEKFPENIGFQTQKGNMLINLSRFDEAESVFQRLIEKFPHQPQGYDGYARLTHSFA
DWNLALKRWENAIEKFPENIGFQTQKGNMLINLSRFDEAESVFQRLIEKFPHQPQGYDGY
ARLTHSFADWNLALKRWENAIEKFPEHIGFQTQKGNMLINLSRFDEAESVFQRLIEKFPH
QPQGYDGYARLTHSFADWNLALKRWENAIEKFPENIGFQTQKGNMLINLSRFDEAESVFQ
RLIEKFPHQPQGYDGYARLTHSFADWNLALKRWENAIEKFPEHIGFQTQKGNILINLSRF
DEAESVFQRLIEKFPHQPQGYDGYAKLTYRFADWNLALKRWENAIEKFPENIGFQTQKGN
MLINLSRFDEAESVFQRLIEKFPHQPQGYDGYARLTHSFADWNLALKRWENAIEKFPENI
GFQTQKGNMLINLSRFDEAESVFQRLIEKFPHQPQGYDGYARLTHSFADWNLALKRWENA
IEKFPENIGFQTQKGNMLINLSRFDEAESVFQRLIEKFPHQPQGYDGYARLTHSFADWNL
ALKRWENAIEKFPEHIGFQTQKGNMLINLSRFDEAESVFQRLIEKFPHQPQGYEGYARLA
NHLGNWELALKRWENAINHLPHHFHFYVQKGNVLITLFRYQEAETLFEELISKYPHQHHG
YDGLARVLMHAQKWELALTCWQTAMDKFPNNLVFLVGKANAYIELHKFDSAQDLADRIFR
QYPNYYQQKYGLQKNIILRRYALEKSIASLSKVEDYFRYLLSESEVFPIAYSCDQILLES
INNLTQTMHHFITLGIIGIAVKRLLDDYFLEVSPGEILACTFKKLITQKLGNENFDLQQA
EILCTEGNFRAAIDIYLNLGDEIIEEFIPDYPEHIDRLFYGIIEHNITADLPEKYGSLSL
AKETLEADLINADFDGDSISIYSQLGYLLVHLGETEKGLAYLNKGVEISIYSQDAYIKLG
YALLKIGKKDSAFANYKQAIKLNFALALLSATLIEWGISKSHQLINSGCQKFEVYQQLSN
LLIQKGLSKEALEVVHKVQNKFGDGHYGKKNLIPILVAQGNKQEALKYYQQVLIENPKSA
DKNLSVLRSCSSLEKFENQTLLQAVMCDRFKIAYAYIPKCACTTIKTVIKFLSSELKKDN
YRINKKISTLKYQDPMEIHRFQKIYLINMGNITTNYFKFVVVREPIKRFLSAFSNKILYS
KESLERTKLTAIQYLSMAQLGVNPEINSMIENLELYSEMSDNWQLHIKPQHTFMGNQIKG
FDRIFQVERLGELGKKLSEITGFEINLPRLNTGGRKISLAELSEKSIKKLIDFYSRDYEL
LKDYYSPEKIWDEYQALKR
Download sequence
Identical sequences Q118K6
WP_011610461.1.43450 203124.Tery_0626 gi|113474480|ref|YP_720541.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]