SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113475573|ref|YP_721634.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113475573|ref|YP_721634.1|
Domain Number 1 Region: 219-542
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.31e-66
Family Integrin alpha N-terminal domain 0.01
Further Details:      
 
Domain Number 2 Region: 1398-1510
Classification Level Classification E-value
Superfamily CalX-like 8.89e-29
Family CalX-beta domain 0.001
Further Details:      
 
Domain Number 3 Region: 1849-1961
Classification Level Classification E-value
Superfamily CalX-like 2.62e-27
Family CalX-beta domain 0.00085
Further Details:      
 
Domain Number 4 Region: 1623-1735
Classification Level Classification E-value
Superfamily CalX-like 4.58e-27
Family CalX-beta domain 0.00085
Further Details:      
 
Domain Number 5 Region: 1736-1848
Classification Level Classification E-value
Superfamily CalX-like 1.44e-26
Family CalX-beta domain 0.001
Further Details:      
 
Domain Number 6 Region: 1965-2111
Classification Level Classification E-value
Superfamily CalX-like 4.19e-26
Family CalX-beta domain 0.00069
Further Details:      
 
Domain Number 7 Region: 1511-1622
Classification Level Classification E-value
Superfamily CalX-like 5.36e-26
Family CalX-beta domain 0.00098
Further Details:      
 
Domain Number 8 Region: 2107-2190
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0000000000248
Family Collagen-binding domain 0.002
Further Details:      
 
Weak hits

Sequence:  gi|113475573|ref|YP_721634.1|
Domain Number - Region: 1225-1396
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00312
Family Fibronectin type III 0.0083
Further Details:      
 
Domain Number - Region: 1133-1299
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0162
Family Fibronectin type III 0.0099
Further Details:      
 
Domain Number - Region: 544-730
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0327
Family Fibronectin type III 0.01
Further Details:      
 
Domain Number - Region: 756-919
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0512
Family Fibronectin type III 0.0099
Further Details:      
 
Domain Number - Region: 941-1010
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0864
Family Fibronectin type III 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|113475573|ref|YP_721634.1|
Sequence length 2194
Comment Na-Ca exchanger/integrin-beta4 [Trichodesmium erythraeum IMS101]
Sequence
MAEFSKDDNSYYPGEPDPLFPETNYHPGTDLDPEIADPIIQCAWGEVRDQLADFILAPEL
EAHMEMAFGETVDSDMAKNEIQDILTGENLPDIQVLPAADMDPVVGGFDSLTGTIYLADS
LWLDTCGAEDGVLEDVLLEELGHFLDSQLSESDSPGDEGELWAGLVKGEELTESEVLRLR
AQDDRVEIWVWGILVEVEATQEVYFERVGDFPVGDEPKSVAVEDFNGDGIPDLAVANYSS
DNVSVLSGKGDGTFGSPTNFLVGDSPSSVAVEDFNGDGIPDLAVANYSSDNVSVLPGKGD
GSFGSTTNFPVGSLPRSVTVEDFNGDGISDLAVANSFSDNVSVLSGKGDGTFGSTTNFRV
GNSPKSVTVEDFNGDGISDLAVANTYSDNVSVLLGKGDGTFGSTTNFPVGDDPLSVAVED
FNGDGIPDLAVANYSSYNLLVLFGKGDGSFGLPTNFQVGDGPYSVAARDFNADGIPDLAV
ANYWDENVSVLFGKGDGSFGSAINFQVGDGPYSVAVEDFNADGIPDLAVANYWDDNVSIL
INTPINITISPLSTTSLEPGKSYTLEWTDNFRDEVKLELYKDNFLQATISSSTPSDGSFS
WTVPTSLTSGSNYNIKMTKVNDSSIYDYSNNFTIEPNKEVNITFPSNFTSLQTGQSYDIQ
WTDNIDENVKLELYKGGSFNSTISSSTESDGSYSWAVPTSVTTGSDYQVKITSISDSSLS
DFSNSNFTIKPEDFITVSSPDGGNTLELGKTYRINWSDNIDENVKLELYKAGSFFGTISS
STASNGSYSWAVPTSLTSGSDYQVKITSVSDSSISDLSNSNFTIKPEDFITVSSPDGGNT
LEPGKTYTINWSDNIDENVKLELYKAGSFFGTISSSTASNGSYSWAVPTSLSTGSDYQVK
ITSISDSSISDLSNSNFTIKPEDFITVSSPDGGNTLELGKTYTINWSDNIDENVKLELYK
AGSFFGTISSSTASNGSYSWAVPTSLTSGSDYQVKITSVSDSSISDLSNSNFTIKPEDFI
TVSSPDGGNTLELGKTYTINWSDNIDENVKLELYKAGSFFGTISSSTASNGSYSWAVPTS
VTSGSDYQVKITSISDSSISDLSNSNFTIKPEDFITVSSPDGGNTLEPGKTYTINWSDNI
DENVKLELYKAGSFFGNISSSTASNGSYSWAVPTSLSTGNDYQVKITSISDSSLSDFSNS
NFTIKPEDFITVSSPDGGNTLEPGKTYTINWRDNIDENVKLELYKAGSFFGNISSSTASN
GSYSWAVPTSLTSGSDYQVKITSISDSSLSDLSNSNFTIKPEDFITVSSPDGGNTLKRGK
NYRITWRDNIDENVKVELYKAGFLFGTISSSTESDGSYSWAVPTSLSTGNDYQVKVTSIS
DGSLSDFSNSNFTIKPEDLAKISIGDTKITEGNTNKAAKFKVTLDNPTTETVKVNYTTAN
QTAKVNQDYKLTKGTLTFRPGETNKTITVPILGDKRDEAEEKFNLNLSRPRNAKLKDAQA
IGTIVDNDQPPQISIGDAKVTEGNKGKKNMEFEVKLNDPSGKTVKVSYGTVEGSAKSGKD
YQKTSGVLTFKPGQRKKILNVPILGDTRDEKNENFQVKLSGAKNAKLSDKNAVGVIRDND
ETVPQISIGDAKVTEGNKGKKNMEFEVELNKGSSKTVKVSYGTVDGSAKSGKDYQKTSGV
LTFKPGQRKKILNVPILGDTREEKNENFQVKLSGAKNAKLSDKNAVGVIRDNDETVPQIS
IGDAKVTEGNKGKKNMEFEVELNKGSSKTVKVSYGTVEGSAKSGKDYQKTSGVLTFKPGQ
RKKILNVPILGDTRDEKNEQFQVKLSGAKNAKLSDKNAVGVIRDNDETVPQISIGDAKVT
EGNKGKKNMEFEVELNKGSSKTVKVSYGTVDGSAKSGKDYQKTSGVLTFKPGQRKKILNV
PILGDTRDEKNENFQVKLSGAKNAKLSDKNAVGVIRDNDEIIGKTPQISIKDTKITEGKK
GEKDMKFEVKLDKSSSQIVRVNYETVDGSAKAGKDYEKKKGVLKFQPGETKKTVNISILG
DTVDEKNENFRIKLSGAKNANLSDKNAIGMIRNNQVPESFKDAVDLGILSSEQTVVVDDI
GFATGPVNRNTEDYFCFKVEKEGLVSIFVDGFIQDLGIKLYGDDESLLNQSNEKGNTTKE
KINTILDPGVYYLKVFPLGVAATEYKLRVNIVDS
Download sequence
Identical sequences Q114B3
203124.Tery_1906 gi|113475573|ref|YP_721634.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]