SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113475717|ref|YP_721778.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113475717|ref|YP_721778.1|
Domain Number 1 Region: 16-302
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-59
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Domain Number 2 Region: 412-531
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 8.24e-32
Family Pentapeptide repeats 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113475717|ref|YP_721778.1|
Sequence length 540
Comment serine/threonine protein kinase [Trichodesmium erythraeum IMS101]
Sequence
MSYCINPACPQPQNLNSVNKCTACGSQLILRDRYKIIKPIGKGGFGVTFLAKDISLPGAP
ICVIKELRPSSTKASELEMARKLFQREAETLGKIGHHPQVPRLLDYFEWKKRFHLVQEYV
SGLTLKQEVKKQGIFTEEQGKKFLIEVLSVIDYIHTQGVIHRDIKPTNIIRRSEDGHLVL
IDFGAVKDHVNQTYISGGTGETAFTNISIGTSGFSPPEQVLLRPVYASDIYALGVTTIFL
LTGKTPNNLGYNQVNGEILWHSQVNVSDMFREILKKMLEVSVEDRFQSAEELLAALKTKQ
PEKKQVQPRLDDAVKTIFRDEITVFNDNKDNFSSMSANIKIAQKIRQRKYGLEKNSTNQV
LPNSVKTKPKHIEGYLTVVPPKSKATNTTQLGNETPIKWTAATLRSAYMKGRRDFAECNL
IRLNLCNAKLSGANFYGANLGGANLQGADLSDSNFGHANLTNTILKNATLTKAYLSTASL
ANSNLQNANMKNTYLSGANLGGANLYGANLTNAIVSDRQLETAKTNWWTIFPNGKRGSIF
Download sequence
Identical sequences Q113L9
203124.Tery_2064 WP_011611676.1.43450 gi|113475717|ref|YP_721778.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]