SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|113476152|ref|YP_722213.1| from Trichodesmium erythraeum IMS101

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|113476152|ref|YP_722213.1|
Domain Number 1 Region: 109-277
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.75e-37
Family Tandem AAA-ATPase domain 0.05
Further Details:      
 
Domain Number 2 Region: 21-77
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000708
Family Eukaryotic type KH-domain (KH-domain type I) 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|113476152|ref|YP_722213.1|
Sequence length 317
Comment PhoH-like protein [Trichodesmium erythraeum IMS101]
Sequence
MTEALKIELPNIDSAIALSGYQEENIKFLAKHTGANVVLRGQELLITGTATQIERCQKII
CSLEKLWKHGKTITGVEILTARHAIETNRQDDLEELQQDVLAKTRRGLEIRAKTFRQRKY
VQAIRRHDMTFCVGPAGTGKTFLGAIIAVKALLDNEYERLILTRPAVEAGEKLGFLPGDL
QQKINPYLRPLYDALYELIEPEKVNTLMEKGVIEVAPLAYMRGRTLNNSFVILDEAQNTT
PAQMKMVLTRLGFRSKMIVTGDITQTDLPLTQRSGLLVAMKILRNVEGISICELSQGDVV
RHPLVKRIVAAYEDYEK
Download sequence
Identical sequences Q111T4
203124.Tery_2538 gi|113476152|ref|YP_722213.1| WP_011612103.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]