SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|152986093|ref|YP_001348456.1| from Pseudomonas aeruginosa PA7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152986093|ref|YP_001348456.1|
Domain Number 1 Region: 8-129
Classification Level Classification E-value
Superfamily PA2201 N-terminal domain-like 4.45e-62
Family PA2201 N-terminal domain-like 0.00000166
Further Details:      
 
Domain Number 2 Region: 138-291
Classification Level Classification E-value
Superfamily PA2201 C-terminal domain-like 1.7e-41
Family PA2201 C-terminal domain-like 0.000000174
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|152986093|ref|YP_001348456.1|
Sequence length 294
Comment hypothetical protein PSPA7_3095 [Pseudomonas aeruginosa PA7]
Sequence
MYAPTPALDNQLADALPQWRDLARTAAVPRRNLDLADWNADWRGLFGALERFSRSHAYRQ
PGAVQGYAALESAWSWGSAAENASTLLLKGIDRGLPGAVLRPVYRETAALWLDYARLLGA
ARDSLRQQGEENFEATPALAPRSGQYPFALQLLAMGVLLDAQDLLPALVEEVLLFDTDRL
LDYLSAAALGLVEASGETFHPRPFGELRAFFEAPDDSAAQALVPYLQREYREFFQLSPKA
QKKTRRLAGPESWGWWAMEVSALSVLYGWDDKALRDSPHYLADLVDYARAQGSD
Download sequence
Identical sequences A0A0V2QW90 A6V5X1
WP_012075855.1.56850 WP_012075855.1.6249 WP_012075855.1.84917 WP_012075855.1.90922 gi|152986093|ref|YP_001348456.1| 381754.PSPA7_3095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]