SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|152987036|ref|YP_001345564.1| from Pseudomonas aeruginosa PA7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152987036|ref|YP_001345564.1|
Domain Number 1 Region: 1-141
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 1.67e-47
Family PA0094-like 0.0000000726
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|152987036|ref|YP_001345564.1|
Sequence length 144
Comment hypothetical protein PSPA7_0168 [Pseudomonas aeruginosa PA7]
Sequence
MTLYRLHEADLEIPDAWQDQSINIFKLPASGPAREASFVISRDASQGDAPFADYVARQLE
NAEKQLPGFKLHKRWDINIHGHAAVLLDYQWQREGRDLMLRQVFIERRPAVLITTLTTTP
GDLPHHEPAWKQAMQTLVPRPAGH
Download sequence
Identical sequences A0A0N8VJB9 A6UXM9
381754.PSPA7_0168 WP_011979144.1.14345 WP_011979144.1.30810 WP_011979144.1.34731 WP_011979144.1.36329 WP_011979144.1.48990 WP_011979144.1.52868 WP_011979144.1.54362 WP_011979144.1.55245 WP_011979144.1.55765 WP_011979144.1.56850 WP_011979144.1.56943 WP_011979144.1.6249 WP_011979144.1.63989 WP_011979144.1.66584 WP_011979144.1.73609 WP_011979144.1.84917 WP_011979144.1.86660 WP_011979144.1.90922 WP_011979144.1.92974 gi|152987036|ref|YP_001345564.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]