SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|152978800|ref|YP_001344429.1| from Actinobacillus succinogenes 130Z

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152978800|ref|YP_001344429.1|
Domain Number 1 Region: 2-205
Classification Level Classification E-value
Superfamily CAC2185-like 4.18e-89
Family CAC2185-like 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|152978800|ref|YP_001344429.1|
Sequence length 206
Comment hypothetical protein Asuc_1128 [Actinobacillus succinogenes 130Z]
Sequence
MLTILRKISNRLFRPAINKRLRRRLKNHRMSVIAGNCNGALILHDLQQQFRSPFVNLYLE
PADFIRYLQNPRHYQQAELVFEQTDKPYPVAKLDDIRLYFVHYHCEREAREKWLSRSSRI
NWDNLFVMTTDRDGCTEQNIADFDALPYPNKVIFTHKAYPQFTSAYYIRGFENQSEVGDL
FEFSGWFGKKYYDQFDYVAWFNGNDG
Download sequence
Identical sequences A6VNE7
gi|152978800|ref|YP_001344429.1| 339671.Asuc_1128 WP_012072871.1.63012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]