SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|124485518|ref|YP_001030134.1| from Methanocorpusculum labreanum Z

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124485518|ref|YP_001030134.1|
Domain Number 1 Region: 30-119
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.00000000000224
Family Intron-encoded homing endonucleases 0.0063
Further Details:      
 
Domain Number 2 Region: 125-165
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000968
Family Recombinase DNA-binding domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|124485518|ref|YP_001030134.1|
Sequence length 175
Comment hypothetical protein Mlab_0695 [Methanocorpusculum labreanum Z]
Sequence
MTPDRKPCLGLRLADRVILSKILTGTWKLDAENGEIISRNTGKPLRFVHKNNGYLSMTTQ
YKGHNVAITKHRAVFIAGTCKTMDDLPVDLNLHIDHINGNIEDCRLANLRLIPFWDNNHP
QSGQKKRIFTDEQVAEIRRRYAEGEPPRVLAPEFGVVKSTIHRIVSRRTYAEVGL
Download sequence
Identical sequences A2SRB1
WP_011833068.1.86236 410358.Mlab_0695 gi|124485518|ref|YP_001030134.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]