SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|124485888|ref|YP_001030504.1| from Methanocorpusculum labreanum Z

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124485888|ref|YP_001030504.1|
Domain Number 1 Region: 280-567
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 4.71e-144
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.0000000023
Further Details:      
 
Domain Number 2 Region: 5-279
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 5.1e-144
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.0000000142
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|124485888|ref|YP_001030504.1|
Sequence length 568
Comment methyl-coenzyme M reductase, alpha subunit [Methanocorpusculum labreanum Z]
Sequence
MAKVEKTQKLFLDALKQKFPKQDVASVQTEFYKFNGVQQSPRKREFMAENKKIEAARGIS
MYDPEHCHLGGIPMGQRQLMTYEVSGTGTFVEGDDLHFVNNAAMQQMWDDIRRTVIVSMD
MAHQTLQKRLGKEVTPETINEYLHVVNHAMPGGAVVQEHMVETHPGLTDDCYVRVFTGDQ
ELADNLEPQFVIDVEKLFPKKQAEALQAAVGKSLWQCVHMPTIVGRTCDGGTTSRWSAMQ
IGMSFIAAYRMCAGEAAVADLSFAAKHAGVINMAHHLPARRARGPNEPGGMLFGNFSDMI
QADRVNPNDPAKASLENVAAGAMLFDQIWLGSYMSGGVGFTQYATAAYTDNILDDFVYSG
MDYIHDKYKVDLKNPNPNDKVKATQEVVNDIATEVNLYGMEQYEQFPTMMEDHFGGSQRA
AVLAAASGITTSIATGNSNAGLNGWYLSMLLHKDGWSRLGFFGYDLQDQCGSANSLSIRP
DEGCIGEFRGPNYPNYAMNVGHQGEYAAIGAAAHFGRGDAWTLSPLIKICFADPALKFDF
AHPRAEFAKGAIREFMPAGERSLIIPAQ
Download sequence
Identical sequences A2SSD1
gi|124485888|ref|YP_001030504.1| 410358.Mlab_1068 WP_011833440.1.86236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]