SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|124486094|ref|YP_001030710.1| from Methanocorpusculum labreanum Z

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124486094|ref|YP_001030710.1|
Domain Number 1 Region: 11-176
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 2.28e-18
Family Terpene synthases 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|124486094|ref|YP_001030710.1|
Sequence length 334
Comment nitrogenase subunit NifH (ATPase)-like protein [Methanocorpusculum labreanum Z]
Sequence
MKEINNSDVLNWLLERDNPSIRYFTLTSLLGRDADDPEVKKAKHAIMTEGLVPQIMEIQN
EDGSWGDPLRFYRDKYTGTSWTLLILAELGADPKDPGIKRACEFILNHSQEPMHGGFSYD
TSAKTGTGLPGGVIPCLTGNMVFSLVKLGYQNDPRVTQAIEWITSYQRADDGIRQPAEGE
PYDRLKMCFGAHSCHMGVAKTLKGLTAIPNHLRTIEINETIKMLTEYFLLHHLYKKSHNL
QEVAKPGWLKPGFPLMYQTDILELLVIFHELGIRDARLQDAVDILKKKRLKNGTWKLEST
FNGKTLVPIEKKGEPSKWITLRSLIVLKEYGIEP
Download sequence
Identical sequences A2SSY7
gi|124486094|ref|YP_001030710.1| 410358.Mlab_1274 WP_011833646.1.86236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]