SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|124486104|ref|YP_001030720.1| from Methanocorpusculum labreanum Z

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124486104|ref|YP_001030720.1|
Domain Number 1 Region: 3-244
Classification Level Classification E-value
Superfamily Aquaporin-like 4.19e-65
Family Aquaporin-like 0.0000284
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|124486104|ref|YP_001030720.1|
Sequence length 248
Comment hypothetical protein Mlab_1284 [Methanocorpusculum labreanum Z]
Sequence
MDLARRCFAELIGTMILVFIGCGSVVIMLMLAAGTTPSTSFDIGIGALGGMGDWFGISAA
FGLAVAAVIYALGTVSGAHINPAVSIALCSIRKFPVKDTIAYVIAQCIGAGIGAALLFFI
IGPESLSVGGLGATAPFPGISLWQALLAEIVGTFILMLVIMGVAVDKKAPAGFAGLAIGA
AVTAVILATGNISGGSINPARSFGPDIMRLILSGSDALWTTYPIYVVGPIVGAVLAAFFY
VFVAGKRE
Download sequence
Identical sequences A2SSZ7
gi|124486104|ref|YP_001030720.1| 410358.Mlab_1284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]