SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|124486142|ref|YP_001030758.1| from Methanocorpusculum labreanum Z

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124486142|ref|YP_001030758.1|
Domain Number 1 Region: 51-225
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 0.0000123
Family Protein prenyltransferases 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|124486142|ref|YP_001030758.1|
Sequence length 327
Comment phosphate transporter [Methanocorpusculum labreanum Z]
Sequence
MNAQEKGDGYTADLLRDGEAWLQYAARSTVLQEDPSSLTDLHDRALADPKIQALIRDIAD
FHGVLVTSHKNAGLPIHKLLFLLDLGFGVEVPEINAAVEAILAHKDENGVYQSKINIPRH
FGGSGEDTFGWALCDAPLLLLALVRAGVDYEASIRQGVAYLLGFFAGDGFPCVVSKELGR
FRGPGKKSDNCPYASLIMLRLLSEIPEYRDSETAKGLADGLLSLWERSLEVHPYMFYMGT
DFRKLKAPALWYDIVSVADVLSRFDFVRQDPGFREMTAVIRGKMREDGLFVPESVYQKFK
GWDFGQKKQPSLYLTFLCRRILERSRQ
Download sequence
Identical sequences A2ST35
410358.Mlab_1324 WP_011833694.1.86236 gi|124486142|ref|YP_001030758.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]