SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|124486420|ref|YP_001031036.1| from Methanocorpusculum labreanum Z

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|124486420|ref|YP_001031036.1|
Domain Number 1 Region: 28-120
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.00000000000612
Family Intron-encoded homing endonucleases 0.0055
Further Details:      
 
Domain Number 2 Region: 127-165
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000986
Family Recombinase DNA-binding domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|124486420|ref|YP_001031036.1|
Sequence length 175
Comment hypothetical protein Mlab_1607 [Methanocorpusculum labreanum Z]
Sequence
MTQEHKPCLGLRLADRVILSRVLAGTWRVDGENGEIISRNTGKPLSFSRKNNGYRSIRAK
YKGFMVDITKHRAVYIGGTCRTMDDLPVDLNLHIDHINGNIDDCRLANLRLIPCWDNNHP
QSGRKLRIFTDEQVGEIRRRYAKGEPPRILAVDFGVARSTIHRIVSRRSYAEVGL
Download sequence
Identical sequences A2STW3
WP_011833972.1.86236 gi|124486420|ref|YP_001031036.1| 410358.Mlab_1607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]