SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|123968221|ref|YP_001009079.1| from Prochlorococcus marinus str. AS9601

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123968221|ref|YP_001009079.1|
Domain Number 1 Region: 94-211
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 5.59e-17
Family Glutathione S-transferase (GST), C-terminal domain 0.015
Further Details:      
 
Domain Number 2 Region: 5-82
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000139
Family Glutathione S-transferase (GST), N-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|123968221|ref|YP_001009079.1|
Sequence length 219
Comment glutathione S-transferase N terminus, partial [Prochlorococcus marinus str. AS9601]
Sequence
MKNDILYSFRRCPYAIRARWALLICEIKVEIREIDLKNKPLDFLNNSKTKTVPILIKKNS
EVIEESLEIILWALSESKKENIKLIYLPENKKEDIFEIINENDNVFKYHLDRFKYATRYK
DSDQEFHFTNAIKFIKRWNELLAEKKYFFGDSPTIADWSIWPFVRQFRIACESQKRTNYF
ESSIKNWLDSFEKNREFKSLMYKYELWEPNSRKNYFPSN
Download sequence
Identical sequences A2BQB1 Q1PK68
gi|123968221|ref|YP_001009079.1| WP_011818134.1.54391 WP_011818134.1.77012 146891.A9601_06861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]