SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|116512838|ref|YP_811745.1| from Lactococcus lactis subsp. cremoris SK11

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116512838|ref|YP_811745.1|
Domain Number 1 Region: 336-474
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.46e-27
Family HD domain 0.027
Further Details:      
 
Domain Number 2 Region: 219-315
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.95e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|116512838|ref|YP_811745.1|
Sequence length 531
Comment phosphodiesterase [Lactococcus lactis subsp. cremoris SK11]
Sequence
MDIISIVLLVLLVVLVVAFIFCAQNIKKNKQDAESLFNEAENKANEVMASAKREAESLKR
EAEAFKKEARYTLREEEQKQRREIEDEFKQERQELKETEKRLKQREEILDRKDDTLTKKE
ENLDSKEENLVRKTDTLSKREEQLAHIEEKKRLELERISNLSMDDAREIILSETRDGLTK
EMAQTIRQSEEKAQAEADKRAKNIISLAIQRVSSDSVAEQTVSVVNLPDDGMKGRIIGRE
GRNIRTFEALTGIDVIIDDTPEAVVLSGFDPIRREIARMTLEQLVQDGRIHPARIEELVE
KNRKALDHKMREYGEQAAFEVGAHNLHPDLMKIMGRLHFRTSYGQNVLDHSVEVAHIAGN
LAGEMGENEALAKRAGFLHDIGKALDHEVEGSHVEIGTELARKYKENPIVINTIASHHGD
TEPLSNIAVLVAAADALSAARPGARRESIENYIKRLKDLEAISTSFDGVETAFALQAGRE
IRVMVKPDKLTDDQIVILARDVKNRIEDEMDYPGNIKVTVIRETRAIDYAK
Download sequence
Identical sequences A0A1V0PBT8 Q02WP0
gi|116512838|ref|YP_811745.1| WP_011676969.1.101083 WP_011676969.1.38190 WP_011676969.1.63588 WP_011676969.1.86027 272622.LACR_2159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]