SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|126459022|ref|YP_001055300.1| from Pyrobaculum calidifontis JCM 11548

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126459022|ref|YP_001055300.1|
Domain Number 1 Region: 1-69
Classification Level Classification E-value
Superfamily SirA-like 0.00000000000183
Family SirA-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|126459022|ref|YP_001055300.1|
Sequence length 70
Comment conserved hypothetical protein [Pyrobaculum calidifontis JCM 11548]
Sequence
METIDVSGQQCPDPLKNVASALAAAPQGARFKIVTDDYVCYMMLRRLMALNEVKILEATE
EGPYILIVEK
Download sequence
Identical sequences A3MT67
gi|126459022|ref|YP_001055300.1| 410359.Pcal_0399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]