SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|126460059|ref|YP_001056337.1| from Pyrobaculum calidifontis JCM 11548

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126460059|ref|YP_001056337.1|
Domain Number 1 Region: 3-73
Classification Level Classification E-value
Superfamily SirA-like 6.93e-25
Family SirA-like 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|126460059|ref|YP_001056337.1|
Sequence length 75
Comment SirA family protein [Pyrobaculum calidifontis JCM 11548]
Sequence
MPKTLDVRGKFCPIPVMETAKAINEVPVGDVLEVLATDPAADPDIRAWAKRMGHEVVSSE
KTAEGYLRIVVRRLK
Download sequence
Identical sequences A3MW54
410359.Pcal_1451 gi|126460059|ref|YP_001056337.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]