SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|126460688|ref|YP_001056966.1| from Pyrobaculum calidifontis JCM 11548

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|126460688|ref|YP_001056966.1|
Domain Number 1 Region: 50-98
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000162
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|126460688|ref|YP_001056966.1|
Sequence length 103
Comment zinc finger, C2H2-type domain protein [Pyrobaculum calidifontis JCM 11548]
Sequence
MAELCFACTDREYAVPVVNVTCTICKKTVSWREAVKHYAEHGKRSGDNVACPLCGAKVKS
REYRRHVRMHFVKRRERGYMCGVCGRSFITLRSLLVHIQKMHE
Download sequence
Identical sequences A3MXY3
gi|126460688|ref|YP_001056966.1| 410359.Pcal_2085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]