SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EFV48875 from Trichinella spiralis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EFV48875
Domain Number 1 Region: 312-567
Classification Level Classification E-value
Superfamily Kelch motif 4.32e-52
Family Kelch motif 0.000043
Further Details:      
 
Domain Number 2 Region: 41-156
Classification Level Classification E-value
Superfamily POZ domain 2.24e-32
Family BTB/POZ domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EFV48875
Sequence length 589
Comment pep:novel chromosome:Tspiralis1:GL627278:928:3757:-1 gene:EFV48875 transcript:EFV48875 description:""
Sequence
XLTSAKHRRCDRKFKYQATPMADSQDDLSTTAEECSPVNQNCILMRTAQRLEEFYRRGLM
CDVCLITGHKRIQAHRVVLAAASDYFHALFTTNMKESLSDEVHIGSIDPDILEAIITYCY
SGVIEVNEMNVENLFQGASMLQVPSVVDRCSELLIEKLHPSNCIGIRSFADRNGCDVLMD
AAEKFVYQNFVEVIKHDEYLLLNVAEVIELLSSDFLNVPNEGIIYEALMLWIMHSKEERV
EYLERLFDVLRIAVLPPKYIVEQIKTNPLIMNSLVCCKQIVDALEFHLCPSARSMFELGI
RCRARKSTLGSVICFGGTDATKKALISEQYDFVNDRWNPVVYASKRVQFGVALFGDRIFF
IGGREGLKTLSVVDVWDYKRDKNVCLTRIPSMNTPRHALGVAVMDDMIFAIGGHDGWTCL
SSAERFDGKEWVKIADMSTARSSFGIAVLNGKIYAVGGRGAGNCHSSVECYHPLRNCWYP
CADMSHPRGNVAVGVLNGFLYAVGGVSSVISKLAIRYTAVERYNPETDEWIYVAHLSSAR
DGIAVCTVGCFLLAIGGYSDKQYENCIAPLKYARAGASAVVFPNVTVYP
Download sequence
Identical sequences EFV48875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]