SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EFV52036 from Trichinella spiralis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EFV52036
Domain Number 1 Region: 42-146
Classification Level Classification E-value
Superfamily L domain-like 6.8e-26
Family Ngr ectodomain-like 0.004
Further Details:      
 
Domain Number 2 Region: 169-271
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000165
Family V set domains (antibody variable domain-like) 0.098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EFV52036
Sequence length 431
Comment pep:novel chromosome:Tspiralis1:GL622792:4527092:4531221:1 gene:EFV52036 transcript:EFV52036 description:""
Sequence
MQISSANAAVENCHDFTAANEQTACNVAKKHNSDALMSVFVLTLDLSGNELDKLEANQFE
GAVRLSELILSKNKIAHIDKDAFQGLPALRRIMLDRNTLSTIYEESFRRLVNLHVLNLMQ
NPWHCNCMLRLFIAWQRNKYLTEPPLCYTPSAVQGKRWDQLTLNEFACAPRAVTWSSRRQ
TVKVGKVIHLECLVSGDPEPTVEWRFYNYDNETTVVGGASGAETNYHKHVDPNSDQSAWI
HHLSVVATSSDVMGLYHCVASNPGGSSYAVFQANEHDNILLITIVVVIAIVLVMVISAVV
IFFRRPSAKQNINSVVSYPAKQSNGYGYVSVTDYGDEATYAHHANAATVEYQREERSTPR
MPDLNVEKWHLVDEDGFYSTKAPYAILNASATRYSRSSATGPAASDRLSDVAPLAADEWE
EPRMPLRETAL
Download sequence
Identical sequences E5ST31
XP_003372019.1.5133 EFV52036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]