SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EFV54348 from Trichinella spiralis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EFV54348
Domain Number 1 Region: 189-253
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000246
Family Ran-binding domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EFV54348
Sequence length 256
Comment pep:novel chromosome:Tspiralis1:GL622789:1718436:1719438:-1 gene:EFV54348 transcript:EFV54348 description:""
Sequence
MNNEQHSVPECEAKYDKEDMILEQLKIITNVQDTTKRLYSIIESGIISRCASQFDGNVET
MRLNNENYAVEKICIPAGTLKTKDALISKYENLKSQEFYDSTTSKMQVSAINGSETVSNS
KSVAEQKIIKRDEKESDSKLQLWANFPTGASSFQRQKQAEKNTEVCSEQQAKSCLSSTIS
KEYKNQEVEDKKSYEEIGTGALKLLFNKRTGTYIIFMSEEKSQKIVLNHGVTSQLNMRPS
SLMNNAFMWQCRNTTD
Download sequence
Identical sequences E5SLJ0
XP_003373474.1.5133 EFV54348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]