SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EFV58915 from Trichinella spiralis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EFV58915
Domain Number 1 Region: 863-974
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000301
Family Pleckstrin-homology domain (PH domain) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EFV58915
Sequence length 991
Comment pep:novel chromosome:Tspiralis1:GL622787:177353:182190:-1 gene:EFV58915 transcript:EFV58915 description:""
Sequence
MAPCLNLHYNCFTVYCPAFGFLKVLMLAKFGKRLGILNSLVIDAVCTSAPQIRENQNENL
LEKREFCEGSDVIEPMEDTKQAKKKTCKRVSFKEIEELQNMVENANSESFAERQKTESAF
LNEAAEVTHEAGNEEEQAERVVVDRFLPMPLTPDRRVSDQKLTFQSSELKCESFSSPSKK
LRKQEESEKYSTADIEISKNELGLNESCNAEIGKRDSPCEGIKSRKARFKALAAEYEAFE
YEYKPAVHRNLPPRRTALGTSSPVLNRNWRSVVTSSESDAVKMTSENDKISYPGEAVELP
KNCNQDESVVDDINNERVVSSVSLQYQSPVERYTEEVRKDCGIEAFVSEKPYINDYVINS
PYKFLKQKSDFEGKQTEKMDDEQSNINLLEECRAKNADLSPSAFIPAGLVASLTKQFEGG
SQLPGPRFVPSRKFKVGTSGEKVDNAAVNEKVECAIIRKSPQRELAEEPFEISNDKVKRL
RSCWEKRVEDAVSKNVELTNDVKGEETSDKEAEIVPSDSSDVETVEKYEEECERKDDSII
EQPQDDSFENCSHNSSVANNVNSDIDYTCTSSVISPEDQMETPVMTKENKPRGSSVLRSV
SSYRNHVKNYMSESTPHRLIYKLPQSKNEDASDGQAESMKLDTLLENYHIKADVGISLRA
ALKIQLEQIHQASRALNLCQSMQEFRGSREERMGICVQNRVDFQPNCPLGTLTVSHISIP
LRRDWVNDNINKTDRIMYYFICLLKYRETVHATHMVTSDDGKQAGRLEFTNYFQFTHLPP
DFRVTLELYSLITGREEIPHEMKYHINGDSGTVSIGGPSGLMDTRFNMVGQLDICLETVQ
RTPPVQGVVILNFRCCAENASAVKESGLLNVFDDSKVPHVWHLYYGVLAEGVLKFWRFPE
DIQKEPLKVIELQSCINEHVRAESEGLSTRNNLIFLEIPNLDSSENTTYKHIFSADNDEE
YIRWVDSLERALHHTRLWRVDDGMKTGSIAL
Download sequence
Identical sequences E5S8F0
EFV58915 XP_003375840.1.5133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]