SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EFV60072 from Trichinella spiralis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EFV60072
Domain Number 1 Region: 309-370
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000502
Family Laminin-type module 0.026
Further Details:      
 
Domain Number 2 Region: 991-1032
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000126
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 3 Region: 880-927
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000226
Family Laminin-type module 0.00072
Further Details:      
 
Domain Number 4 Region: 781-832
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000363
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 5 Region: 424-473
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000419
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 6 Region: 368-426
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000237
Family Laminin-type module 0.02
Further Details:      
 
Domain Number 7 Region: 471-526
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 8 Region: 1039-1086
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000106
Family Laminin-type module 0.0082
Further Details:      
 
Domain Number 9 Region: 935-988
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000209
Family Laminin-type module 0.0037
Further Details:      
 
Domain Number 10 Region: 836-882
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000306
Family Laminin-type module 0.0064
Further Details:      
 
Weak hits

Sequence:  EFV60072
Domain Number - Region: 745-783
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000698
Family Laminin-type module 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EFV60072
Sequence length 1253
Comment pep:novel chromosome:Tspiralis1:GL622785:6401625:6408122:1 gene:EFV60072 transcript:EFV60072 description:""
Sequence
MDTPIKTVVSTSAQEELDEYPQSSGRCVDENGVAQRCVPEFINAAFNRPVEVTNTCGLSR
PVEFCVQTGHSGMNKVCDVCDARVSSQAHPSFYLTDFNNPNNETWWQSETMAEGIQYPTT
VNMTINLVVKLEIIVLLHIYSNVNDCPVQGSLVIQCAWSDVAISKAFDITYVRLKFRSPR
PESFAIYKKSRADSDWSPWQYYSATCRSTYGVPEKAPILPNAEAVAQCSAEYSDISPLTG
GNVAFSTLEGRPSAHNFEESSVLQDWVTASEIRIVLTRLNTFGDEVFRDIKVLRSYYYAV
SDFAIGGRCKCNGHASRCVKSTGHGEEKLVCQCEHNTHGEDCDECLPFFNNRPWKAATAE
NANECQACDCNGLSNRCYFDEELYRMTGNGGHCINCAGNTRGAHCEACLENYWRAPGQQT
CLPCNCNEIGSVNMQCDDSGQCICKPGVGGQHCDRCLPGFYEFSALGCRDCGCLESGSLD
NQPSCRSDTGDCTCKRNVEGRQCERCRPGFFNLDLENEFGCTPCFCFGHSSVCDSALGYY
KSNITSTFDSCNFILFFAFLNYYYYPLFVLMYTARDGWKAERYDGRETELQYNLMDQAVS
VAEFDGPSYFIAPGKFRGNQRSAYNQILSFKLKVVQSNARASVRDIVLEGADGQVISVPV
FAQGNPVPASYEQIYRYRLHESADFGWTPSLSTTKFLGLLSNVTALKIRGTFAAGDVGGL
DDVILQSASMTPNGEELGQRAMWIESCQCPDNFVGQFCESCAPGFRREPKFGGPFSRCIK
CECHGHADLCEAESGRCICEHNTAGDNCERCARGFYGNALNGTVNDCIACPCPDSGPCLL
HTDDDIICLDCPNGYAGRRCEICSDGYFGEPSNGRNCTFCKCSGNIDPNSVGNCDRTTGE
CKKCIYNTHGFECEKCLPGFYGDALLEPKGDCKPCDCYSFGTYKPRTDYDFLECQQNDGQ
CQCLNHVTGRRCDQCENGYYNISSGEGCQPCNCDPLGSLNTSCDINTGQCVCKPGVIGRR
CDQCAMRHFGFGPKGCEACNCLVMGSVNLQCSITTGQCQCHPNIEGRQCDRCKENMYNLE
AGCLECPPCYKLIQKYAKQHREKLDELKDLLAEIIANPMVINDTNFEKKLAEVHEDVTKF
GVEVKERLAGGDSSLIKRVSKLRDDITKAEESLADVDHLLLETNFTISEAVNIMSSWDRI
KEKSYAELRHAQYFLNNDAVEAWNRARLASDRFGRPSEEMTNLAEEARQLAER
Download sequence
Identical sequences E5S550
EFV60072 XP_003380312.1.5133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]