SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EFV60708 from Trichinella spiralis 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EFV60708
Domain Number 1 Region: 58-174
Classification Level Classification E-value
Superfamily PH domain-like 4.37e-28
Family Phosphotyrosine-binding domain (PTB) 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EFV60708
Sequence length 186
Comment pep:novel chromosome:Tspiralis1:GL622785:3819343:3821142:-1 gene:EFV60708 transcript:EFV60708 description:""
Sequence
MYAHSFATGVLEHSISSASSPPRKVVLLTSLNCTNLLHAALFLFILSYANCTCYTDQHYI
GSMEMFRPATRIEIVAAMRRVRYEFKARGISKKKVDLIISIDGIKVIMRKRKKKHRGVWD
ESECLVMFHPIYRVFYVSHDSQDLQIFSYIARDGSNNTFKCNVFKCSKKNKGILHLRLIS
QASINR
Download sequence
Identical sequences E5S3B9
XP_003379670.1.5133 EFV60708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]