SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125972540|ref|YP_001036450.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125972540|ref|YP_001036450.1|
Domain Number 1 Region: 258-597
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 3.8e-62
Family alpha-L-arabinanase-like 0.00011
Further Details:      
 
Domain Number 2 Region: 29-165
Classification Level Classification E-value
Superfamily AbfB domain 2.09e-44
Family AbfB domain 0.0002
Further Details:      
 
Domain Number 3 Region: 174-242
Classification Level Classification E-value
Superfamily Type I dockerin domain 6.67e-19
Family Type I dockerin domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|125972540|ref|YP_001036450.1|
Sequence length 707
Comment alpha-L-arabinofuranosidase B [Clostridium thermocellum ATCC 27405]
Sequence
MANRTFKFIVLLFTTVLFATSVCYSTNPITKAKFQSYNYPNMYIRHANFDARIDENVTPE
MDSQWELVPGLANSGDGYVSIQSVNYPGYYLRHSNYDLSLEKNDGTSLFAESATFKIVPG
LADPSYISFQSYNFPTRYIRHYNYLLRLDEIVTELDRQDATFKIISEDTQPPAPTLIGDV
NADGKIDSTDLTLLKRYLLRSATLTEEKILNADTDGNGTVNSTDLNYLKKYILRVISVFP
AEGNKPPTPTPTKTPVATPSPTQPLFTPSFKDVTVHDPSVIKTNGTYYVIGSHLAFAKTN
DLIQWQQINSSVYTGNPLIPNVFDELKEAFEWAKTDTMWAGDIIQLRDGKYYMYYCMCKG
DSPLSALGVARADKVEGPYKNLGILLRSGAGKGEDGTNYNATIHPNAVDPHTFFDKNGDL
WMVYGSYSGGIYILKMNPSTGKQYPGQGYGKKLLGANHSRIEGPYIQYSPDTGYYYLFLS
FGGLTADGGYNIRVARSQNPDGPYYDAEGNNMINCRGPAGSFFDDRAIEPYGVKLMGNFR
FVDSGIGYVSPGHNSTYYDEESGKYFIIFHTRFPGKGEMHQVRVHQMFINEDGWPVIAPH
RYAGETIRRYSPEEVAGTYAYINHGRDISANIKNSVRISLNKDGTVSGNGVNGRWELSGE
HYIRLTVNGTNYTGVVLQQWDDGLKKYVMTFSAISRNGNVTIWGSQL
Download sequence
Identical sequences A3DBC8
203119.Cthe_0015 gi|125972540|ref|YP_001036450.1| gi|385779539|ref|YP_005688704.1| WP_003511909.1.19387 WP_003511909.1.20586 WP_003511909.1.31213 WP_003511909.1.55520 WP_003511909.1.60145 WP_003511909.1.6636 WP_003511909.1.6965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]