SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125972556|ref|YP_001036466.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125972556|ref|YP_001036466.1|
Domain Number 1 Region: 177-515
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.42e-58
Family beta-glycanases 0.00019
Further Details:      
 
Domain Number 2 Region: 521-589
Classification Level Classification E-value
Superfamily Type I dockerin domain 3.63e-20
Family Type I dockerin domain 0.00035
Further Details:      
 
Domain Number 3 Region: 34-158
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000255
Family delta-Endotoxin, C-terminal domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|125972556|ref|YP_001036466.1|
Sequence length 590
Comment glycoside hydrolase family protein [Clostridium thermocellum ATCC 27405]
Sequence
MGKIFGRTLSLLVTFAMVFSVLLVMPVSTYAAYSLPVDVEAEDCTLGNGAVVTTNVYGTQ
YPGYSGDGFVWVANSGTITLEVTIPENGMYELSTRCWMYLGKEDETRMQVISINGKSHSN
YFIPNKGQWIDYSFGFFYLEAGKATIEIGSSGSWGFILYDKIYFDHADMPDHIIDPTPCD
PNATPETRALMKYLTSVYGKYVISGQQEIYGNGNDGNYELEFDYIYEKTGKYPAIRGFDF
MNYNPLYGWEDGTTARIIDWVKNRGGIATACWHINIPRDFASYKLGEPVDWTNCTYKPTS
SFNTANCLDETTKEHAYLMMAIEDLAEQLLILQEQNIPILFRPFHEAEGYNNTDGSGAWF
WWGSAGAEVYKELWKLLYKTLTEKYGIHNLIWEVNLYTYANSYEWYPGDEYVDIIGYDKY
EGSPNTWGTSAASSLFLTLVNYTNDTKMVALTENDVIPDIQNIVNEEAWWLYFCPWYGDF
LMSPRYNDPVLLNTIYNSEYVITLDELPENLYEYDGEIPDINYGDLNNDGNINSTDYMIL
KKYILKVLERMNVPEKAADLNGDGSINSTDLTILKRFIMKAITKFPVTQK
Download sequence
Identical sequences A3DBE4
WP_003511942.1.16390 WP_003511942.1.19387 WP_003511942.1.20586 WP_003511942.1.31213 WP_003511942.1.55520 WP_003511942.1.60145 WP_003511942.1.6636 WP_003511942.1.6965 NYSGXRC-11095m gi|125972556|ref|YP_001036466.1| 203119.Cthe_0032 gi|385779528|ref|YP_005688693.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]