SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125972568|ref|YP_001036478.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125972568|ref|YP_001036478.1|
Domain Number 1 Region: 469-531
Classification Level Classification E-value
Superfamily Type I dockerin domain 5.49e-16
Family Type I dockerin domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|125972568|ref|YP_001036478.1|
Sequence length 533
Comment dockerin type I cellulosome protein [Clostridium thermocellum ATCC 27405]
Sequence
MRKFFKLTALTISMMLLVVCLTGPQVSAASRPEGWTEETHGKKATPNYSVVFPEDKVNRI
DIIISPENFQRMENDVFKVFMMSNEDPIYVSATVKFNNHTWWHVGIRYKGQSTLTGAMMS
MSHKYPFRLNFDKFEDDYPEIDNQRFYGFDELIFNNNWYDPSFLRDKLTSDIFRDAGIPA
PRCAFYRVYVDTGNGPVYWGLYTVFEDPSDKMLEYQFENPNGNLYKGQQAPGGDLTIFDK
RGYEKKTNEKADDWSDLQALVAALNAPKTDPAKWRADLEAVFNTDSFLKWLAINTTIVNF
DTYGWVTKNHYLYQDLADNGRLVFIPWDYNLSLSSTNPWGIKPPSFSLDEIGRNWPLIRN
LIDDPVYKHIYHTEIENTLNIYFREFNVIEKARRLHELIRPYTVGSEGEIKGYTYLTNGE
AQFNQALTQLIEHISTRHREARSYLSSVNYYTPIPERTPTPFPSPTPKKPKGDINLDGKI
NSTDLSALKRHILRITTLSGKQLENADVNNDGSVNSTDASILKKYIAKAIPSL
Download sequence
Identical sequences A3DBF6
WP_003511967.1.16390 WP_003511967.1.31213 WP_003511967.1.60145 gi|125972568|ref|YP_001036478.1| 203119.Cthe_0044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]