SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125972575|ref|YP_001036485.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125972575|ref|YP_001036485.1|
Domain Number 1 Region: 143-229,360-405
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.000000000116
Family YicI catalytic domain-like 0.053
Further Details:      
 
Weak hits

Sequence:  gi|125972575|ref|YP_001036485.1|
Domain Number - Region: 85-306
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.00232
Family Amylase, catalytic domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|125972575|ref|YP_001036485.1|
Sequence length 419
Comment hypothetical protein Cthe_0051 [Clostridium thermocellum ATCC 27405]
Sequence
MLKNKQLLMALSVFLIVFTTTYAFVYYNDGLNKNNRKINDNQNIQIKHFLPNENGNNENG
SENNNEEESLSSPRPERKPVKVKGLYITGTSAGNKKFMERLVNLINTTELNTVVLDVKED
GKVNYASEVESVKKIGAYHELYNVDEVIKLLHDNNIYVIGRIVCFRDNYLAGKRVDLAIK
RKDGSIWRENGSIAWTNPYNKEVWRYNIDIAKEAVKKGFDEIQFDYVRFPAAGKNEVDYG
ENPIPKADAISGFLKEAASEINKMGVPVSADIFAIVCETPGDTEGIGQVLERIGMDIDYI
SPMIYPSHFANASRGMMGNGKGQSINGILFTAPDLKPYEVVYNVLLKTKDRISKVEGYRA
KVRPYLQGFTASYLPKGYYQHYGPEQIRQQIKAVYDAGYEEWIFWNAANTYTESAFARE
Download sequence
Identical sequences A3DBG3
gi|385779507|ref|YP_005688672.1| WP_003518392.1.19387 WP_003518392.1.20586 WP_003518392.1.31213 WP_003518392.1.55520 WP_003518392.1.6636 WP_003518392.1.6965 203119.Cthe_0051 gi|125972575|ref|YP_001036485.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]