SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125972576|ref|YP_001036486.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125972576|ref|YP_001036486.1|
Domain Number 1 Region: 149-334
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.00000000000441
Family Type II chitinase 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|125972576|ref|YP_001036486.1|
Sequence length 419
Comment hypothetical protein Cthe_0052 [Clostridium thermocellum ATCC 27405]
Sequence
MSAKNAQTILSNKCFSVILVVLVLVFSLAACKDTGVQVNNPAPTAQATDNVEANNGGNTD
GEAPETSEPSEESPVPNNSGEDAKPVKKDIKVKALYLTGWTVGSDERLQHYVDLANRTEI
NAYVVDIKDDDGYVGYESNIPAVREIGAWKSKYNVDKVLKTFHDNNIHVIGRLVCFKDPV
LSSKKPELAVKSVNGGSWRDNHNLTWLDPYNKDSWPYLIEIAKEAVEKGFDEIQFDYIRF
PNDGSKKSMSFNTGGKEKHEIINEFLAYAREQLPGVVLSADVFGIILESPADTEDIGQYL
EKIVKDVDYISPMVYPSHYAVGQIVNGVQFMKPDLDPYGVVYQSLVKCNNRLAQVEGYKA
DVRPYIQDFTASWLGKGYYQSYGPEQLRQQIQAVYDAGYEEWICWDANNTYSEEAFLKE
Download sequence
Identical sequences A3DBG4
WP_011837743.1.31213 gi|125972576|ref|YP_001036486.1| 203119.Cthe_0052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]