SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125972633|ref|YP_001036543.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|125972633|ref|YP_001036543.1|
Domain Number - Region: 51-90
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00017
Family Type I dockerin domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|125972633|ref|YP_001036543.1|
Sequence length 105
Comment dockerin type I cellulosome protein [Clostridium thermocellum ATCC 27405]
Sequence
MSRRGALVLLVISLLVTAFLPTAVFAQDVPFSGKSDNVPSFTQPIPVKHLYELIHLCIWE
RGYDRLVDFNSDSSVNSTDLMILNRAVLGLGGLPVPIEIGDYRID
Download sequence
Identical sequences A3DBM1
WP_011837752.1.16390 WP_011837752.1.31213 203119.Cthe_0109 gi|125972633|ref|YP_001036543.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]