SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125972639|ref|YP_001036549.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125972639|ref|YP_001036549.1|
Domain Number 1 Region: 186-654
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 4.64e-92
Family Glycosyltransferase family 36 C-terminal domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|125972639|ref|YP_001036549.1|
Sequence length 659
Comment glycogen debranching protein [Clostridium thermocellum ATCC 27405]
Sequence
MNFGKSSWRTYEQGIQREWLLTNGIGGFASSTIIGSNTRRYHGLLVAALKPPVSRHLILS
KIDECVTVDNESFNLFSYEVPGFIMHGYHHLERFEYDMLPKYIYRVKDVYVEKEICMVYG
ENTVVVVYHVINGTGRTNLRLTPLVNFRDYHFNSGRAYMSFERKFEKDVLTVRPSCYDID
IKLYSTDGKFTELDDTWFYNMDYAVERERGLASTEDHYIPGYYDIEIKPLEEKYITFVAT
VEKNVNHRDGLKIIEKEKKRLKKLASKAGYKDELAKKLVLAADKFIVHRESTNAKTVIAG
YPWFTDWGRDTMISLAGLTLATRRFEDAKEILYTFSKYVKDGLIPNMFPDAGHEPPYNTV
DAALWYFEAVNKYVNYTHDYKFIKENIYSGLKQIIEYYSKGTHFNIKADEDYLISAGDEH
TQLTWMDAKVGDWVVTPRHGKAVEINALWYNALKIMSQLSKHFKEDAGLYDEMAEKVKKS
FEEKFWNEEKKCLYDCLTPNYKDDKVRPNQILAVSLSYPVIEGEKAKSVVDIVFKELYTA
YGLRSLSPKEKEYVGVYMGDQYRRDGAYHQGTVWTWPLGHFITAYLRVNNYSPEARKMAL
RFIEPFKDHLQDACLGSVSEIFDGNEPLIPRGCFAQAWSVAEILRAYVEDVMQLVQLKH
Download sequence
Identical sequences A3DBM7
203119.Cthe_0115 Cth-3163 gi|385779443|ref|YP_005688608.1| gi|125972639|ref|YP_001036549.1| WP_003512126.1.19387 WP_003512126.1.20586 WP_003512126.1.31213 WP_003512126.1.55520 WP_003512126.1.60145 WP_003512126.1.6636 WP_003512126.1.6965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]