SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125972714|ref|YP_001036624.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125972714|ref|YP_001036624.1|
Domain Number 1 Region: 223-595
Classification Level Classification E-value
Superfamily Serpins 1.96e-102
Family Serpins 0.00000233
Further Details:      
 
Domain Number 2 Region: 146-214
Classification Level Classification E-value
Superfamily Type I dockerin domain 1.83e-19
Family Type I dockerin domain 0.00036
Further Details:      
 
Domain Number 3 Region: 71-144
Classification Level Classification E-value
Superfamily Purple acid phosphatase, N-terminal domain 0.0000353
Family Purple acid phosphatase, N-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|125972714|ref|YP_001036624.1|
Sequence length 600
Comment proteinase inhibitor I4, serpin [Clostridium thermocellum ATCC 27405]
Sequence
MQKKLICFLVFALLSSFLFVGNSFADGNWKTYYELYPDPVVTDTSAVIRFKIIKVKIDDY
ITMPGYVYDVEYWKTDEPSNVMHSYNILWGESSKQISEGISEVVYRTELTGLEPNTEYTY
KIYGQMPIRNKEGTPETITFKTLPKKLVYGELNGDGKINSSDLNMMKRYLLRLIDGLNDT
ACADLNGDGKINSSDYSILKRYLLRMIDKFPVEKEEKNEGVSENFIRGNSNFAFNIFKEI
NKDEQGKNVFISPFGISTALSMVYQGAKSDTREEMAKVLGYEGLDIEEVNKSYKYLLQYF
NGLDNDTKIKSSNSIWMNSLHGNAIKEDFISTNKDVFDALAETRDFSDKGVVDEINDWIS
KATEGQIDKMLSEIDMDMLAYIISALYFKGTWTEEFDIEKTVSVPFASEDGGADHVMMMR
KELCTIEFGEGDGYKAVRLPYGDGEMAMYCILPDEDTSINDFIQKLDLSMWEKIKNSITK
RENGTIYLPRFKMEYAKGESGSIMESLKALGMKKAFEEDADLSGMTEADAFISDVLHKAV
VEVNEKGTEASGVVVIPIAPTSIAPGPKFIANRPFAFVIADEKYDTILFMGKLCDGGLIN
Download sequence
Identical sequences A3DBV2
203119.Cthe_0190 gi|385779370|ref|YP_005688535.1| gi|125972714|ref|YP_001036624.1| WP_003512269.1.16390 WP_003512269.1.19387 WP_003512269.1.20586 WP_003512269.1.31213 WP_003512269.1.55520 WP_003512269.1.60145 WP_003512269.1.6636 WP_003512269.1.6965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]