SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125972715|ref|YP_001036625.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125972715|ref|YP_001036625.1|
Domain Number 1 Region: 215-592
Classification Level Classification E-value
Superfamily Serpins 1.1e-96
Family Serpins 0.00000262
Further Details:      
 
Domain Number 2 Region: 126-194
Classification Level Classification E-value
Superfamily Type I dockerin domain 1.57e-17
Family Type I dockerin domain 0.00065
Further Details:      
 
Domain Number 3 Region: 55-117
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000377
Family Fibronectin type III 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|125972715|ref|YP_001036625.1|
Sequence length 599
Comment proteinase inhibitor I4, serpin [Clostridium thermocellum ATCC 27405]
Sequence
MLPGFALLSSFLLVGNSFAANWYTYYELYPDPVVTDTSAVIRFKLTTEKIDDYITMPGYI
YEFRYWKVDEPSKVKSVSIGLYVNEVQTVELTDLEPNTEYECKVWGQIYTSNKEGTPKTI
TFKTLPKKGDLNGDAKINSTDLNMMKRYLLQMIDRFGVDDESCADLNGDGKITSSDYNLL
KRYILHLIDKFPIGNDETDEGINDGFNDETDEDINDSFIEANSKFAFDIFKQISKDEQGK
NVFISPFGISMALSMVYQGAESDTREEMAKVLGYEGLDIEEVNKSYKLLLKYFNELIGNV
KLKNSNSIWKNSLKGDVIKEDFISVNKDVFNALVETRDFSDESVVDKINNWISDATEGKV
KKALNAVNPDELLYIISALYFNGAWKEEFEFDINDTTMSTFKSEDGSTDYVMMMRKSYNN
WVGVMEFGKGDGYSAIRLPYGNGEMAMYCILPDEDISINDFIQNLDVSLWNEIKNSIRKT
LQGLICLPRFKIEYFKDGNGSIKESLKALGLEKVFSLAEADLTGMSETNAYVSDVLHKAV
VEVNEKGTEASSSVVVIPVPGFGTRSEFIADRPFVFIIADEKYDTILFMGKLAKGELIN
Download sequence
Identical sequences A3DBV3
gi|385779369|ref|YP_005688534.1| WP_003518070.1.19387 WP_003518070.1.20586 WP_003518070.1.31213 WP_003518070.1.55520 WP_003518070.1.6636 WP_003518070.1.6965 203119.Cthe_0191 gi|125972715|ref|YP_001036625.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]