SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125972735|ref|YP_001036645.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125972735|ref|YP_001036645.1|
Domain Number 1 Region: 26-244
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.92e-59
Family Glycosyl hydrolases family 16 0.000000375
Further Details:      
 
Domain Number 2 Region: 269-332
Classification Level Classification E-value
Superfamily Type I dockerin domain 3.04e-17
Family Type I dockerin domain 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|125972735|ref|YP_001036645.1|
Sequence length 334
Comment glycoside hydrolase family protein [Clostridium thermocellum ATCC 27405]
Sequence
MKNRVISLLMASLLLVLSVIVAPFYKAEAATVVNTPFVAVFSNFDSSQWEKADWANGSVF
NCVWKPSQVTFSNGKMILTLDREYGGSYPYKSGEYRTKSFFGYGYYEVRMKAAKNVGIVS
SFFTYTGPSDNNPWDEIDIEFLGKDTTKVQFNWYKNGVGGNEYLHNLGFDASQDFHTYGF
EWRPDYIDFYVDGKKVYRGTRNIPVTPGKIMMNLWPGIGVDEWLGRYDGRTPLQAEYEYV
KYYPNGVPQDNPTPTPTIAPSTPTNPNLPLKGDVNGDGHVNSSDYSLFKRYLLRVIDRFP
VGDQSVADVNRDGRIDSTDLTMLKRYLIRAIPSL
Download sequence
Identical sequences A3DBX3
WP_003512300.1.16390 WP_003512300.1.19387 WP_003512300.1.20586 WP_003512300.1.31213 WP_003512300.1.55520 WP_003512300.1.60145 WP_003512300.1.6636 WP_003512300.1.6965 gi|125972735|ref|YP_001036645.1| 203119.Cthe_0211 gi|385779352|ref|YP_005688517.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]