SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125972736|ref|YP_001036646.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125972736|ref|YP_001036646.1|
Domain Number 1 Region: 26-471
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.09e-174
Family Family 1 of glycosyl hydrolase 0.000000000382
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|125972736|ref|YP_001036646.1|
Sequence length 471
Comment beta-glucosidase [Clostridium thermocellum ATCC 27405]
Sequence
MFPLGYNYIITLFANNILKGVVNMSKITFPKDFIWGSATAAYQIEGAYNEDGKGESIWDR
FSHTPGNIADGHTGDVACDHYHRYEEDIKIMKEIGIKSYRFSISWPRIFPEGTGKLNQKG
LDFYKRLTNLLLENGIMPAITLYHWDLPQKLQDKGGWKNRDTTDYFTEYSEVIFKNLGDI
VPIWFTHNEPGVVSLLGHFLGIHAPGIKDLRTSLEVSHNLLLSHGKAVKLFREMNIDAQI
GIALNLSYHYPASEKAEDIEAAELSFSLAGRWYLDPVLKGRYPENALKLYKKKGIELSFP
EDDLKLISQPIDFIAFNNYSSEFIKYDPSSESGFSPANSILEKFEKTDMGWIIYPEGLYD
LLMLLDRDYGKPNIVISENGAAFKDEIGSNGKIEDTKRIQYLKDYLTQAHRAIQDGVNLK
AYYLWSLLDNFEWAYGYNKRFGIVHVNFDTLERKIKDSGYWYKEVIKNNGF
Download sequence
Identical sequences WP_003520797.1.16390 WP_003520797.1.19387 WP_003520797.1.20586 WP_003520797.1.31213 WP_003520797.1.55520 WP_003520797.1.60145 WP_003520797.1.6636 gi|125972736|ref|YP_001036646.1| 203119.Cthe_0212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]