SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125972761|ref|YP_001036671.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125972761|ref|YP_001036671.1|
Domain Number 1 Region: 981-1049
Classification Level Classification E-value
Superfamily Type I dockerin domain 1.44e-18
Family Type I dockerin domain 0.00035
Further Details:      
 
Domain Number 2 Region: 186-304
Classification Level Classification E-value
Superfamily Lamin A/C globular tail domain 0.0000000000262
Family Lamin A/C globular tail domain 0.014
Further Details:      
 
Domain Number 3 Region: 34-148
Classification Level Classification E-value
Superfamily Lamin A/C globular tail domain 0.000000000209
Family Lamin A/C globular tail domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|125972761|ref|YP_001036671.1|
Sequence length 1051
Comment dockerin type I cellulosome protein [Clostridium thermocellum ATCC 27405]
Sequence
MKKVISGAVVIALLFAIMIPARYFGAFAEASQTLFINEVMSSNVFTIRDGDVTDPKHGSK
GGAYSDWIEIYNAGPYDVDLTGYILADSSAEWVFPQGIVPAGGYLLVWASDKNMVAQDGQ
LHTNFKLSASGENITLKKPDGTIVDSVDIIGLGDDQSYGRKSDGASEFVVFINPTPGAAN
VYNAPGTSTLFINEVMASNTRTIRDGDVDDPKDGSKGGAYSDWIEIYNAGPYDVDLTGYI
LADSSAEWVFPQGIVPAGGYLLVWASDKNKVATDGGLHTNFKISSSGEALTLKDPDGNVI
DILVTINLLDDQAYGRKTDGSSELVLLKPTPGTANIYDPSLIPVSEPVFSHQGGFYTGAF
KLELTTNEPGVKIYYTTDGSDPVPGKSGTIEYTSGINIKSRKGEANVLSMIQDISNDQWN
RWRAPNGEVFKCTTIKAVAIRDDGARSKVVTHSYFVDPQMNTRYTLPVISIVTDYDNFFD
KSTGIYVNGNYENRGKEWERPVHIEYFETDGKLGFSMDMGLRIHGGYTRKYPQKSFRLYA
DHNNDIGEIKYEIFPGLRGTGTGKKIKSFERLILRNAGNDWTGALFRDEMMQSLVSHLKI
DTQAFRPCIVFLNGEYWGIYHIRERYDDKYLKSHYGLDDDKVAILDVYQTPEVQEGDSSD
VLAYTNDVINYLKTHSITEKSTYDYIKTKIDIENYIDYYVAQIFFGNTDWPGNNVSIWRY
KTDDGQYHPEAPYGQDGRWRWMLKDTDFGFGLYGKSPSHNTLAFAAGDIREGQANEEWAV
FLFKTLLKNEEFRNEFINRFADQLNTSFVPSRVISIIDDIVATLEPEMKEHTDRWPFIKL
TATSPWDTTWSQEVNRIRNYANSRPSYVRQHILSKFRNNGVTGTALVTLNTDSTRGHIRI
NSIDIVSDTPAVTNPNRWSGTYFKGVPITLKAIPKEGYVFDHWEGINGSVEASSDTITVN
LSNDLNVTAVFRPENETPDPEILYGDYNGDGAVNSTDLLACKRYLLYALKPEQINVIAGD
LDGNGKINSTDYAYLKRYLLKQIDKFPVQLK
Download sequence
Identical sequences A3DBZ9
WP_003512367.1.31213 WP_003512367.1.60145 gi|125972761|ref|YP_001036671.1| 203119.Cthe_0239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]