SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125972791|ref|YP_001036701.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125972791|ref|YP_001036701.1|
Domain Number 1 Region: 40-393
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 4.76e-102
Family Cellulases catalytic domain 0.00000000000124
Further Details:      
 
Domain Number 2 Region: 411-477
Classification Level Classification E-value
Superfamily Type I dockerin domain 7.98e-22
Family Type I dockerin domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|125972791|ref|YP_001036701.1|
Sequence length 477
Comment glycoside hydrolase family protein [Clostridium thermocellum ATCC 27405]
Sequence
MKNVKKRVGVVLLILAVLGVYMLAMPANTVSAAGVPFNTKYPYGPTSIADNQSEVTAMLK
AEWEDWKSKRITSNGAGGYKRVQRDASTNYDTVSEGMGYGLLLAVCFNEQALFDDLYRYV
KSHFNGNGLMHWHIDANNNVTSHDGGDGAATDADEDIALALIFADKLWGSSGAINYGQEA
RTLINNLYNHCVEHGSYVLKPGDRWGGSSVTNPSYFAPAWYKVYAQYTGDTRWNQVADKC
YQIVEEVKKYNNGTGLVPDWCTASGTPASGQSYDYKYDATRYGWRTAVDYSWFGDQRAKA
NCDMLTKFFARDGAKGIVDGYTIQGSKISNNHNASFIGPVAAASMTGYDLNFAKELYRET
VAVKDSEYYGYYGNSLRLLTLLYITGNFPNPLSDLSGQPTPPSNPTPSLPPQVVYGDVNG
DGNVNSTDLTMLKRYLLKSVTNINREAADVNRDGAINSSDMTILKRYLIKSIPHLPY
Download sequence
Identical sequences A3DC29
gi|125972791|ref|YP_001036701.1| WP_003512420.1.16390 WP_003512420.1.19387 WP_003512420.1.20586 WP_003512420.1.31213 WP_003512420.1.55520 WP_003512420.1.60145 WP_003512420.1.6636 203119.Cthe_0269 gi|385779293|ref|YP_005688458.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]