SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125972792|ref|YP_001036702.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125972792|ref|YP_001036702.1|
Domain Number 1 Region: 30-297,363-393
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.02e-103
Family Type II chitinase 0.000000356
Further Details:      
 
Domain Number 2 Region: 415-483
Classification Level Classification E-value
Superfamily Type I dockerin domain 4.22e-19
Family Type I dockerin domain 0.00025
Further Details:      
 
Domain Number 3 Region: 297-362
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.0000000000199
Family Chitinase insertion domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|125972792|ref|YP_001036702.1|
Sequence length 484
Comment glycoside hydrolase family protein [Clostridium thermocellum ATCC 27405]
Sequence
MKKIPLLMLLSAIIFLSLHPTLSYAQDDSLPTKRIVGYFAEWNIYLENNYYEVSDIPWDM
VTHINYAFAKIENGRIAIIDKWAAIQKPFGDDTWDTPIRGHFGQLIKYKEQYPHVKTLIS
VGGWTESKYFSDVALTEESRNTFADSCVEFIRTYRFDGVDIDWEYPVSGGMPENIRRPED
KQNFTLLLKCLREKLDAAGAEDGKHYLLTIAAPAGSFNIKNTEPEIYHQYLDFINIMTYD
YSGSWENVANHLAPLYMNPNDPSYPERKEKFNVDWTVKEYLRLGVPAEKINVGVPYYAAG
WQEVNGGINGLFGTSSKPLSSTQFHYINSLLKSPDLGFTRYWDEYAMVPYLWNPESATFY
SYEDEISLKNKCDYVIENNLGGIMIWELSGDYPAEGGTTLTSVIYDSFTSFKDEIYGDLN
GDGKVNSSDLAILKRYMLRAISDFPIPEGRKLADLNRDGNVNSTDYSILKRYILKAIDNI
PVDD
Download sequence
Identical sequences A3DC30
gi|385779292|ref|YP_005688457.1| gi|125972792|ref|YP_001036702.1| WP_003518171.1.16390 WP_003518171.1.19387 WP_003518171.1.20586 WP_003518171.1.31213 WP_003518171.1.55520 WP_003518171.1.6636 WP_003518171.1.6965 203119.Cthe_0270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]