SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125972796|ref|YP_001036706.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125972796|ref|YP_001036706.1|
Domain Number 1 Region: 29-457
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 3.27e-147
Family Cellulases catalytic domain 0.0000000000415
Further Details:      
 
Domain Number 2 Region: 480-554
Classification Level Classification E-value
Superfamily Type I dockerin domain 1.57e-16
Family Type I dockerin domain 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|125972796|ref|YP_001036706.1|
Sequence length 563
Comment glycoside hydrolase family protein [Clostridium thermocellum ATCC 27405]
Sequence
MRKIAVLLITLTFLVTTLFSMSFSSAAASHDYATALKYSILFYDANKCGPDAAVDNVFSW
RGPCHTTDGSEIGLDLTGGYHDAGDHVKFGLPQAYAAAVLGWSLYEYKGVFDATGNTSKM
LSTLKYFTDYLLKCHPDSNTFYYQVGDGQADHTYWGAPEVQPGPRPVPYVANASNAASDV
CGLTSAALTIMYLNYKDIDQNYANKCLKAAKELYTMAKTNLGYYAENAFYISHSYWDDLS
FAATWLYVVEKDPTYLKEIDSYLSNKTLWGESPFNNKWTMCWDDMYMAVFCKLAEITGEQ
KYIDAMNYNLDYWMNSLNTTPGGLKYLDSWGVLRYAAAEAFIAMRYYELTKNEALKSFAK
SQIDYILGSNPINMSYVIGYGSNYPKCPHHRAANGYTYANGDNAKPAKNLLLGALVGGPN
MSDNFIDDVNQFQFTEVAIDYNAAFVGALAAIEKYYGNIVIPTPPATTPPSPTATPSLIW
CDVGDLNVDGSINSVDITYMKRYLLRSISVLPYQENERIRIPAADTNGDGAINSSDMVLL
KRYVLRSISEFPVKYDIYGNIIN
Download sequence
Identical sequences A3DC34
gi|125972796|ref|YP_001036706.1| 203119.Cthe_0274 gi|385779288|ref|YP_005688453.1| WP_003518175.1.19387 WP_003518175.1.20586 WP_003518175.1.31213 WP_003518175.1.55520 WP_003518175.1.6636 WP_003518175.1.6965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]