SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125972813|ref|YP_001036723.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125972813|ref|YP_001036723.1|
Domain Number 1 Region: 173-538
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 1.91e-92
Family Cellulases catalytic domain 0.045
Further Details:      
 
Domain Number 2 Region: 6-134
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.8e-36
Family Thioltransferase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|125972813|ref|YP_001036723.1|
Sequence length 680
Comment hypothetical protein Cthe_0291 [Clostridium thermocellum ATCC 27405]
Sequence
MSAYKQANRLIHEKSPYLLQHAYNPVDWYPWCDEAFEKAKRENKPIFLSIGYSTCHWCHV
MESESFEDEEVAEILNKNFVSIKVDREERPDIDSIYMTACQALTGHGGWPLTIIMTPDKK
PFFAGTYFPKKDRMGMPGLISILKSVHNTWVNEKDSLAKYSSKVVSVISESIDDDYYYSV
DEITEDIFEDAFSQFKYDFDNIYGGFGNAPKFPMPHNLYFLLRYWHKAKEEYALVMVEKT
LDSMYSGGIYDHIGFGFCRYSTDEKWLVPHFEKMLYDNALLAIAYLETYQATKNKKYADI
AKEIFTYVLRDMTSPEGGFYSAEDADSEGEEGKFYIWSPTEIKEVLGESDGEKFCKYYNI
TEEGNFEGLNIPNLINSTIPDEDKEFVELCRKKLFDHREKRVHPHKDDKILTAWNGLMIA
ALAIGGRVLGIEKYTLAAEKASEFIFSKLVRPDGRLLARYRDGEAAFLAYLDDYAFLIWA
LIELYETTYKPMYLKKAMELTNDMIKYFWDNKKGGLFIYGSDSEQLITRPKEIYDGAIPS
GNSVAALNFLRLSRLTGQQELEEKAHQMFALFGSKIDSMPQGYAFFLTAMLFSKSKSNEV
VLVGSNEKDTQNMLSILSEDFRPFTTSILYSEEHKDLKELIPFIDNYTTIENKPTAYVCE
NFVCHEPITDGALLREKLNR
Download sequence
Identical sequences A3DC51
Cth-3628 gi|125972813|ref|YP_001036723.1| 203119.Cthe_0291 WP_003512463.1.16390 WP_003512463.1.19387 WP_003512463.1.20586 WP_003512463.1.31213 WP_003512463.1.55520 WP_003512463.1.60145 WP_003512463.1.6636 gi|385779271|ref|YP_005688436.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]