SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125972843|ref|YP_001036753.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125972843|ref|YP_001036753.1|
Domain Number 1 Region: 55-438
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.47e-104
Family NagZ-like 0.0000263
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|125972843|ref|YP_001036753.1|
Sequence length 444
Comment glycoside hydrolase family protein [Clostridium thermocellum ATCC 27405]
Sequence
MKKRVHILIMTLMLIVACVGCSGSSDNPPPANSLHSASTIPISAMPSFSTPSPTVEDTEN
QQSKTVNYLINSMTLEEKIGQIFIVAFRKGKSSRPLKVLDNSTKLKIQNFNPGGIILFSE
NIDTIPQTQKLIRDMQEASKIPMFIAVDEEGGRIARIGNNPKMHSTKIPSAQTIGLADDP
ELAYEAGRILGAELSALGFNMNFAPVADVNTNPDNPVIGDRSFGSDPYKVGLMVQAMSKG
MQEQNVCTVLKHFPGHGDTSYDSHLGQVVINHDIERLRQIELTPFKMGIKAGADGVMTAH
IIMPNITGSNLPATLSEEILSGLLRNELKHEKLIITDAMEMKAISNYWSSSKAAVMAFKA
GADIILMPESFEEAYNGILKAVKDGEITEERLNQSLQRILALKFERNILANKESSVDPEK
VLGRQEHTDIVVKIMQKAEEQNIP
Download sequence
Identical sequences A3DC81
203119.Cthe_0322 Cth-709 gi|385779241|ref|YP_005688406.1| WP_003519336.1.16390 WP_003519336.1.19387 WP_003519336.1.20586 WP_003519336.1.31213 WP_003519336.1.55520 WP_003519336.1.6636 WP_003519336.1.6965 gi|125972843|ref|YP_001036753.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]