SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125972956|ref|YP_001036866.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125972956|ref|YP_001036866.1|
Domain Number 1 Region: 35-104
Classification Level Classification E-value
Superfamily Type I dockerin domain 5.4e-17
Family Type I dockerin domain 0.0013
Further Details:      
 
Weak hits

Sequence:  gi|125972956|ref|YP_001036866.1|
Domain Number - Region: 190-298
Classification Level Classification E-value
Superfamily Lysozyme-like 0.0675
Family G-type lysozyme 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|125972956|ref|YP_001036866.1|
Sequence length 350
Comment dockerin type I cellulosome protein [Clostridium thermocellum ATCC 27405]
Sequence
MKRKILIVFVLLSIAISQFLYFEVGCFDVYAWNKAVIGDVNADGVVNISDYVLMKRYILR
IIADFPADDDMWVGDVNGDNVINDIDCNYLKRYLLHMIREFPKNSYNSAPTFTPIPTFTP
TPTPTKAPAAPANTQSGILNDGYFPPGTSKHELIARASSLKVSEVKAIIKKQVDEHWDVI
RDVCGFKNKEVAYAFFFGMATRESTFRAATETGSGASHAFGPLQTAETAYANANPNYMPE
HNVPEMHQYDFTEYNFYDVGISVHMGIRHFLHFARLAKEKYSGRDIARHGLMGYNTGWID
GADESWIVRYADETAALGAWYLRNNHMSDDEFTWDTDPRVDRSNPWEIYY
Download sequence
Identical sequences A3DCJ4
gi|125972956|ref|YP_001036866.1| 203119.Cthe_0435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]