SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125972959|ref|YP_001036869.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125972959|ref|YP_001036869.1|
Domain Number 1 Region: 68-127
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000657
Family Type I dockerin domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|125972959|ref|YP_001036869.1|
Sequence length 128
Comment dockerin type I cellulosome protein [Clostridium thermocellum ATCC 27405]
Sequence
MLKFQRNFGKYYLFKGYVQMRKIKIINYFPLFFMLFIVILRVFFVSSSAEVANTADTNIK
LLQNSEAPFKYGDLNGDNNINSSDYTLLKRYLLHTIRESPEKRPHPHFGEKYSGVDNLSN
LIDLSYLK
Download sequence
Identical sequences A3DCJ7
gi|125972959|ref|YP_001036869.1| 203119.Cthe_0438 WP_003519077.1.19387 WP_003519077.1.20586 WP_003519077.1.31213 WP_003519077.1.55520 WP_003519077.1.6636 WP_003519077.1.6965 gi|385779125|ref|YP_005688290.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]