SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125973055|ref|YP_001036965.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125973055|ref|YP_001036965.1|
Domain Number 1 Region: 38-444
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.53e-68
Family beta-glycanases 0.00000559
Further Details:      
 
Domain Number 2 Region: 497-562
Classification Level Classification E-value
Superfamily Type I dockerin domain 8.14e-20
Family Type I dockerin domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|125973055|ref|YP_001036965.1|
Sequence length 563
Comment glycoside hydrolase family protein [Clostridium thermocellum ATCC 27405]
Sequence
MKKFLVLLIALIMIATLLVVPGVQTSAEGSYADLAEPDDDWLHVEGTNIVDKYGNKVWIT
GANWFGFNCRERMLLDSYHSDIIADIELVADKGINVVRMPIATDLLYAWSQGIYPPSTDT
SYNNPALAGLNSYELFNFMLENFKRVGIKVILDVHSPETDNQGHNYPLWYNTTITEEIFK
KAWVWVAERYKNDDTIIGFDLKNEPHTNTGTMKIKAQSAIWDDSNHPNNWKRVAEETALA
ILEVHPNVLIFVEGVEMYPKDGIWDDETFDTSPWTGNNDYYGNWWGGNLRGVKDYPINLG
KYQSQLVYSPHDYGPIVYEQDWFKGDFITANDEQAKRILYEQCWRDNWAYIMEEGISPLL
LGEWGGMTEGGHPLLDLNLKYLRCMRDFILENKYKLHHTFWCINIDSADTGGLFTRDEGT
PFPGGRDLKWNDNKYDNYLYPVLWKTEDGKFIGLDHKIPLGRNGISISQLSNYTPSVTPS
PSATPSPTTITAPPTDTVTYGDVNGDGRVNSSDVALLKRYLLGLVENINKEAADVNVSGT
VNSTDLAIMKRYVLRSISELPYK
Download sequence
Identical sequences P04956
gi|385779044|ref|YP_005688209.1| 203119.Cthe_0536 NYSGXRC-11095n WP_003517581.1.19387 WP_003517581.1.20586 WP_003517581.1.31213 WP_003517581.1.55520 WP_003517581.1.6636 WP_003517581.1.6965 gi|125973055|ref|YP_001036965.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]