SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125973097|ref|YP_001037007.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125973097|ref|YP_001037007.1|
Domain Number 1 Region: 28-479
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 1.06e-154
Family Cellulases catalytic domain 0.00000000000826
Further Details:      
 
Domain Number 2 Region: 492-637
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 1.1e-45
Family Cellulose-binding domain family III 0.0000135
Further Details:      
 
Domain Number 3 Region: 663-734
Classification Level Classification E-value
Superfamily Type I dockerin domain 5.4e-17
Family Type I dockerin domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|125973097|ref|YP_001037007.1|
Sequence length 736
Comment glycoside hydrolase family protein [Clostridium thermocellum ATCC 27405]
Sequence
MKKLIITVIVSAVLLTALIPQLPVFAADYNYGEALQKAIMFYEFQMSGKLPDNIRNNWRG
DSCLGDGSDVGLDLTGGWFDAGDHVKFNLPMAYTATMLAWAVYEYKDALQKSGQLGYLMD
QIKWASDYFIRCHPEKYVYYYQVGNGDMDHRWWVPAECIDVQAPRPSYKVDLSNPGSTVT
AGTAAALAATALVFKDTDPAYAALCIRHAKELFDFAETTMSDKGYTAALNFYTSHSGWYD
ELSWAGAWIYLADGDETYLEKAEKYVDKWPIESQTTYIAYSWGHCWDDVHYGAALLLAKI
TNKSLYKEAIERHLDYWTVGFNGQRVRYTPKGLAHLTDWGVLRHATTTAFLACVYSDWSE
CPREKANIYIDFAKKQADYALGSSGRSYVVGFGVNPPQHPHHRTAHSSWCDSQKVPEYHR
HVLYGALVGGPDASDAYVDDIGNYVTNEVACDYNAGFVGLLAKMYEKYGGNPIPNFMAIE
EKTNEEIYVEATANSNNGVELKTYLYNKSGWPARVCDKLSFRYFMDLTEYVSAGYNPNDI
TVSIIYSAAPTAKISKPILYDASKNIYYCEIDLSGTKIFPGSNSDHQKETQFRIQPPAGA
PWDNTNDFSYQGIKKNGEVVKEMPVYEDGILIFGVEPNGTGPATPTPKPSVNPSPSPTPT
SDILYGDINLDGKINSSDVTLLKRYIVKSIDVFPTADPERSLIASDVNGDGRVNSTDYSY
LKRYVLKIIPTIPGNS
Download sequence
Identical sequences A3DCY5
gi|125973097|ref|YP_001037007.1| 203119.Cthe_0578 WP_011837874.1.31213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]