SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125973123|ref|YP_001037033.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125973123|ref|YP_001037033.1|
Domain Number 1 Region: 240-369
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.35e-42
Family NlpC/P60 0.002
Further Details:      
 
Domain Number 2 Region: 58-94
Classification Level Classification E-value
Superfamily SH3-domain 0.00000443
Family SH3-domain 0.0045
Further Details:      
 
Weak hits

Sequence:  gi|125973123|ref|YP_001037033.1|
Domain Number - Region: 185-219
Classification Level Classification E-value
Superfamily SH3-domain 0.00103
Family SH3-domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|125973123|ref|YP_001037033.1|
Sequence length 370
Comment peptidase PgdS [Clostridium thermocellum ATCC 27405]
Sequence
MLKFNKVFMYITASALSVSLWTCTSFAQQNKTGVTTASMLNMRENPSTSTKIIDQIPNGT
KVDIIETSNGWYKISYNGKTGWVYGSYVKVTETPKLTVTDETILATLNKGSTGNSSTNSS
TNNSAVNNSSSQVVDETIQKPAQNAASGENTENTVVKTGIVKASALNVRQGPGTSYSIIN
QLSNGAKVNIIKEESGWYQIKLANGSTGWVSGTYVNVNTTIASRGGLSENSAPAASNNSD
VSGVRQQVVEYAKKFLGVKYVYGGNSPSQGFDCSGFVKYVFSNFGINLERVAASQAKQGT
WVSKDQLLPGDLVFFDTDGGHNYINHSGIYIGDGKFIHASSGSGKKSVVISDLTSGFYAN
TYMTARRVLN
Download sequence
Identical sequences A3DD11
WP_004463247.1.31213 WP_004463247.1.60145 CmR87 Cth-2549 gi|125973123|ref|YP_001037033.1| 203119.Cthe_0605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]