SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125973143|ref|YP_001037053.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125973143|ref|YP_001037053.1|
Domain Number 1 Region: 29-466
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 1.39e-132
Family Cellulases catalytic domain 0.000000000548
Further Details:      
 
Domain Number 2 Region: 471-626
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 4.71e-43
Family Cellulose-binding domain family III 0.0000177
Further Details:      
 
Domain Number 3 Region: 640-710
Classification Level Classification E-value
Superfamily Type I dockerin domain 2.75e-18
Family Type I dockerin domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|125973143|ref|YP_001037053.1|
Sequence length 710
Comment glycoside hydrolase family protein [Clostridium thermocellum ATCC 27405]
Sequence
MVKKTLCFVLTLAMLTAFILPQGIVSAAGSYNYAEALQKAIYFYECQQAGPLPEWNRVEW
RGDATMNDEVLGGWYDAGDHVKFNLPMAYSAAMLGWALYEYGDDIEASGQRLHLERNLAF
ALDYLVACDRGDSVVYQIGDGAADHKWWGSAEVIEKEMTRPYFVGKGSAVVGQMAAALAV
GSIVLKNDTYLRYAKKYFELADATRSDSTYTAANGFYSSHSGFWDELLWASTWLYLATGD
RNYLDKAESYIPKLNRQNQTTDIEYQWAHCWDDCHYGAMILLARATGKEEYHKFAQMHLD
WWTPQGYNGKRVAYTPGGLAHLDTWGPLRYATTEAFLAFVYADSINDPALKQKYYNFAKS
QIDYALGSNPDNRSYVVGFGNNPPQRPHHRTAHGTWLDKRDIPEKHRHVLYGALVGGPGR
DDSYEDNIEDYVKNEVACDYNAGFVGALCRLTAEYGGTPLANFPPPEQRDDEFFVEAAIN
QASDHFTEIKALLNNRSSWPARLIKDLSYNYYMDLTEVFEAGYSVDDIKVTIGYCESGMD
VEISPITHLYDNIYYIKISYIDGTNICPIGQEQYAAELQFRIAAPQGTKFWDPTNDFSYQ
GLTRELAKTKYMPVFDGATKIFGEVPGGFEPVPSPSPTPAQYKVGDLNGDGVVNSTDSVI
LKRHIIKFSEITDPVKLKAADLNGDGNINSSDVSLMKRYLLRIIDKFPVE
Download sequence
Identical sequences A3DD31 Q9AJF8
gi|125973143|ref|YP_001037053.1| gi|385778950|ref|YP_005688115.1| 203119.Cthe_0625 WP_003520969.1.16390 WP_003520969.1.19387 WP_003520969.1.20586 WP_003520969.1.31213 WP_003520969.1.55520 WP_003520969.1.60145 WP_003520969.1.6636 WP_003520969.1.6965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]