SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125973158|ref|YP_001037068.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125973158|ref|YP_001037068.1|
Domain Number 1 Region: 49-429
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.65e-37
Family iota-carrageenase 0.032
Further Details:      
 
Domain Number 2 Region: 511-580
Classification Level Classification E-value
Superfamily Type I dockerin domain 2.75e-20
Family Type I dockerin domain 0.00058
Further Details:      
 
Weak hits

Sequence:  gi|125973158|ref|YP_001037068.1|
Domain Number - Region: 417-540
Classification Level Classification E-value
Superfamily Anthrax protective antigen 0.0772
Family Anthrax protective antigen 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|125973158|ref|YP_001037068.1|
Sequence length 582
Comment dockerin type I cellulosome protein [Clostridium thermocellum ATCC 27405]
Sequence
MPKKVLCVVMIFVLFMSFTISTAAYNAEINGEVIVWNPGIKGGIPTKPVVANVKDFGAKG
DGLTDDSNAFKKAVESVKDGGAVLIPSGEYLIKSKITLDKPVVLRGEGPGKTILLIDHSS
DAFEVITYKRGNWVSLVGGYTRGSTELVVSDPTGFEAGKYVEIQQDNDPDVMYTLPEWNQ
GWAAGSVGQITKVVSIWGNKITIEEPLRITYRSELNPVIRTQGFAEYIGFEDFTVKRIDT
SDTNMFFFKNAANCWIKNIHSIKPAKAHVSVTTGYRIEVRDSFFDDATNWGGGGHGYGVE
LGFHVSDCLIENNIFKHLRHSMMVHLGANGNVFGYNYSTQPYQSEGGNWTPADISVHGHY
AYSNLFEGNIVQEITVSDYWGPSGPYNTFLRNRIESESVCLEDSSNYQNFIGNEIVNGNI
LWDTDNRYPHKIDPSTLFLHGNLINGSIQWNQQTQDRTIPNSYYLDSKPAFFGGINWPST
GSDRTDGTIPAKERYYGNTIPPASPTPDKPVKYGDLNGDNNVNSTDLTLLKRYLTRVIND
FPHPDGSVNADVNGDGKINSTDYSAMIRYILRIIDKFPAEKS
Download sequence
Identical sequences A3DD46
203119.Cthe_0640 gi|385778934|ref|YP_005688099.1| gi|125973158|ref|YP_001037068.1| WP_003516585.1.16390 WP_003516585.1.19387 WP_003516585.1.20586 WP_003516585.1.31213 WP_003516585.1.55520 WP_003516585.1.60145 WP_003516585.1.6636 WP_003516585.1.6965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]