SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|125973179|ref|YP_001037089.1| from Clostridium thermocellum ATCC 27405

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|125973179|ref|YP_001037089.1|
Domain Number 1 Region: 51-341
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 4.43e-54
Family alpha-L-arabinanase-like 0.0071
Further Details:      
 
Domain Number 2 Region: 352-491
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.46e-43
Family Ricin B-like 0.0048
Further Details:      
 
Domain Number 3 Region: 505-566
Classification Level Classification E-value
Superfamily Type I dockerin domain 2.55e-16
Family Type I dockerin domain 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|125973179|ref|YP_001037089.1|
Sequence length 571
Comment Ricin B lectin [Clostridium thermocellum ATCC 27405]
Sequence
MVKKNVGLRFLSILILMALLIGNVQSFNVAAAEGVIVNGTQFKDTSGNVIHAHGGGMLKH
GDYYYWYGEYRDDSNLFLGVSCYRSKDLVNWEYRGEVLSRNSAPELNHCNIERPKVMYNA
STGEFVMWMHWENGINYGQARAAVAYSKTPDGKFTYIRSFRPMQDTGVMDHGLPGYMSRD
CNVFVDTDGKGYFISAANENMDLHLYELTPDYKNIASLKAKLFVGQQREAPCLIKRNGYY
YLITSGCTGWNPNQAKYAYSKDLASGWSQLYNLGNSTTYRSQPTFIIPVQGSSGTSYLYM
GDRWAGAWGGKVNDSQYVWLPLNFISDTTLELPYYDSVKIDASSGIISEYIPDTTRYKLV
NKNSGKVLDVLDGSVDNAAQIVQWTDNGSLSQQWYLVDVGGGYKKIVNVKSGRALDVKDE
SKEDGGVLIQYTSNGGYNQHWKFTDIGDGYYKISSRHCGKLIDVRKWSTEDGGIIQQWSD
AGGTNQHWKLVLVSSPEPSPSPSPQVVKGDVNGDLKVNSTDFSMLRRYLLKTIDNFPTEN
GKQAADLNGDGRINSSDLTMLKRYLLMEVDL
Download sequence
Identical sequences A3DD67
CmR13 WP_011837884.1.31213 gi|125973179|ref|YP_001037089.1| 203119.Cthe_0661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]